KEGG Orthology (KO) [BR:pguu00001]
09100 Metabolism
09104 Nucleotide metabolism
00240 Pyrimidine metabolism
104466085 (DUT)
09111 Xenobiotics biodegradation and metabolism
00983 Drug metabolism - other enzymes
104466085 (DUT)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:pguu03400]
104466085 (DUT)
Enzymes [BR:pguu01000]
3. Hydrolases
3.6 Acting on acid anhydrides
3.6.1 In phosphorus-containing anhydrides
3.6.1.23 dUTP diphosphatase
104466085 (DUT)
DNA repair and recombination proteins [BR:pguu03400]
Eukaryotic type
Other factors with a suspected DNA repair function
Modulation of nucleotide pools
104466085 (DUT)
Prokaryotic type
104466085 (DUT)
166 aa
MPASDSVLQPSPNKRQKGSASGEPTARLRFTKLSENAYAPSRGSARAAGYDLYSAYDCAI
PPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGK
ETFEVKKGDRIAQLICERIFYPELEEVQVLDDTERGEGGFGSTGKN
