KEGG   Polymorphum gilvum: SL003B_3170
Entry
SL003B_3170       CDS       T01458                                 
Name
(GenBank) Predicted TRAP C4-dicarboxylate transport system permease (DctM-like)
  KO
K11690  TRAP-type transport system large permease protein
Organism
pgv  Polymorphum gilvum
Pathway
pgv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SL003B_3170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pgv02000]
    SL003B_3170
Transporters [BR:pgv02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SL003B_3170
SSDB
Motif
Pfam: DctM Na_H_antiporter
Other DBs
NCBI-ProteinID: ADZ71592
UniProt: F2IXG9
LinkDB
Position
complement(3413726..3415021)
AA seq 431 aa
MTIALIGFVVLFLLLFFGFPLALALGFVGYFGFGYLIAFKPAGAMVAQITWDTLSSYSLS
VLPLFLLMGNLVNHAGLSRELYAASNAFVGHRRGGLAIATIIACGGFAAVCGSSLATAAT
MSAIALPSMKRYGYSDSLSAGSVAAGGTLGILIPPSVIMVIYGSITETSIGQLFIAGIVP
GVMGILLYILAVIAVVTLRPEAGPRGPRLAWRERFAALGTVWTTLVLFIVVIGGIYLGVF
TATEAAGVGATGAFFIALLRRTLTVRSLLKLLLETARTTAMLMAVLVGALIFSNFVNVAG
VPSAVVQFINGFGLSPMGVILLLIVFYLVLGAVFDSLAMILLTVPVFFPLVVGLGFDPIW
FGILVVVVVEISLITPPIGMNIFVIRTVLHNVKTTEIYKGILPFIAADFIRLALIVLLPW
LVLYLPQQMAQ
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgaccatcgcgctgatcggcttcgtcgtactcttcctgctgctgttcttcggctttccg
ctggcgctggcgctcggcttcgtcggctatttcggcttcggctacctgatcgcctttaag
cctgccggcgcgatggtcgcgcagatcacctgggacacgctgtcgagctattcgctctcc
gtgctgccgctgttcctgctgatgggcaacctggtcaaccacgccggcctgtcgcgcgag
ctttatgccgcctccaacgccttcgtgggtcaccggcgcggcggccttgccatcgcgacc
atcatcgcctgcggcggctttgcggccgtctgcggctcaagcctggccaccgccgcgacc
atgtcggcgatcgcgctgccctcgatgaagcgctacggctattccgattccctgtcggcc
ggctcggtcgccgccggcggcacgctcggcatcctgatcccgccctccgtgatcatggtg
atctacggcagcatcaccgagaccagcatcggccagctgttcatcgccggcatcgtgccg
ggcgtgatgggcatcctgctgtacatcctggcggtcatcgcggtggtcacgctgcggccg
gaggccggcccgcgcgggccgcgcctggcctggcgcgagcgcttcgcggcgctcggcacg
gtctggacgacgctggtgctgttcatcgtggtcatcggcggcatctatctcggcgtcttc
acggcgacggaggctgccggcgtcggcgctaccggcgcgtttttcatcgccctgctgcgt
cgcacgctgacggtccgctcgctgctcaagctgctgctggagacggcgcgcaccacggcc
atgctgatggccgtgctggtaggcgcgctgatcttctccaacttcgtcaacgtcgccggc
gtgccgagcgcggtggtacaattcatcaacggcttcggtctgtcgccgatgggcgtgatc
ctgctcctgatcgtgttttacctggtgctcggggcggtgttcgattcgctggcgatgatc
ctgctgacagtgccggtgttcttcccgctggtcgtcggcctcggcttcgacccgatctgg
ttcggcatcctcgtcgtcgtggtggtcgagatcagcctgatcacgccgccgatcggcatg
aacatctttgtcatccgcacggtgctgcacaacgtcaagacgacggagatctacaagggt
atcctgccgttcatcgccgccgacttcattcgcctcgcgctgatcgtgctgctgccctgg
ctggtgctctacctgccgcagcagatggcacaatga

DBGET integrated database retrieval system