KEGG   Polymorphum gilvum: SL003B_4095
Entry
SL003B_4095       CDS       T01458                                 
Symbol
bphAa
Name
(GenBank) IPB-dioxygenase, ISP large subunit (IpbA1)
  KO
K08689  biphenyl 2,3-dioxygenase subunit alpha [EC:1.14.12.18]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00621  Dioxin degradation
pgv01100  Metabolic pathways
pgv01120  Microbial metabolism in diverse environments
pgv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    SL003B_4095 (bphAa)
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     SL003B_4095 (bphAa)
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ADZ72512
UniProt: F2J6M9
LinkDB
Position
4401320..4402624
AA seq 434 aa
MIDEKRGVYDPKIYTDESLYRLELERIFARTWICMGHESQIAKPGDFITAYIGEDPVVVV
RQKDGSIRVFLNQCRHRGMRICRADSGNAKAFTCTYHGWAYNQGGDLVSVPMEQEAFGGC
LNKKEWGPKQARVETYKGLIFANWDADAPSLDEYLGEAKFYMDIMLDRCEGGTEALPGVQ
KWVIPCNWKFAAEQFASDAYHAGTTSHLSGIMAGVPEDVDLSQVAPPTSGLNVHMSNGHG
CGLFLRNPMFYMTILGPKVTEYLTSGPAYEEATRRLGKSRTDVHLCHCNIFPNLSFLAGI
NTVRMWQPRGPHEIEVWTFGVVDKTAPDDIKEEWRRNISRTFTAGGVFEQDDGENWCDIQ
QVLKGHVAQQQKFNIEMASHTVSTENPEGFPGISFAYTYGEESARGFYRYWTQIMTAPDW
PSIRKIQQQPVAAE
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgatcgacgagaagcgcggcgtctacgatccgaagatctataccgatgaatcgctctac
aggctcgagctggagcgcatcttcgcgcggacgtggatctgcatgggtcacgaatcgcag
atcgcgaagcccggcgacttcatcaccgcctacatcggcgaggatccggtggtggtggtg
cgtcagaaggatggcagcatccgggtgttcctgaatcagtgtcggcatcgcgggatgcgg
atctgccgtgcggattcgggcaatgccaaggcattcacctgcacctaccatggctgggcc
tataatcagggtggcgatctggtcagtgtcccgatggagcaggaggccttcggtggctgc
ctgaacaagaaggaatgggggccgaagcaggcgcgtgtcgaaacctacaagggtctgatc
ttcgcgaactgggatgccgacgcgccctcgctggacgaatacctcggcgaagcaaagttc
tacatggacatcatgctcgaccgttgcgaaggcggcacagaggcgctgccgggcgtccag
aagtgggtgatcccctgcaactggaaatttgccgccgaacagttcgcgtcggacgcctat
catgcgggaaccacctcgcatctgtcgggcatcatggcgggtgtgcccgaggatgtcgat
ctctctcaggtcgcgccaccgacctcggggctgaacgtgcatatgtcgaacggtcacggt
tgtggcctgttcctgcgcaacccgatgttctacatgacgattctcggtccgaaggtgacc
gaatacctgacctcggggccggcctacgaggaagcgacgcgccgcttgggcaagtcgcgg
acggatgtgcatctgtgccattgcaacattttcccgaacttgtccttccttgccgggatc
aacacggtccgcatgtggcagccgcgcggtccccatgaaatcgaagtctggacgttcggc
gtcgtggacaagaccgccccggacgacatcaaggaggaatggcgccgcaatatttcccgg
accttcacggccggcggcgtgttcgagcaggatgacggcgagaactggtgcgacatccag
caggtgctgaagggtcacgttgcccagcagcagaaattcaatatcgagatggccagccac
acggtttcgaccgagaatcccgaggggtttccggggatcagcttcgcctatacctatggt
gaggaatcggcgcgcggtttttatcggtactggacccagatcatgaccgcaccggactgg
ccttcgatccgcaagatccagcaacagcctgtggcagctgaatag

DBGET integrated database retrieval system