KEGG   Polymorphum gilvum: SL003B_4096
Entry
SL003B_4096       CDS       T01458                                 

Gene name
bphAb
Definition
(GenBank) Biphenyl 2,3-dioxygenase beta subunit
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00621  Dioxin degradation
pgv01100  Metabolic pathways
pgv01120  Microbial metabolism in diverse environments
pgv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    SL003B_4096 (bphAb)
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     SL003B_4096 (bphAb)
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: ADZ72513
UniProt: F2J6N0
LinkDB
Position
4402710..4403267
AA seq 185 aa
MLDSTFKSAFERKPKAVSLELQHEVEQFLYWEAKLLTDRRYQEWFDLLATDLRYWMPIRS
TRIMREVAQEYTDENGFAHFDDNWHTMKGRIRKIMSDVGWSENPASRLRYLVGNVMIVPE
SDDTLNVVSAVMVYRTRQERQLDVFACERQDVLRRVASEAGFQIASRKILIDQSTILSNN
LSFFF
NT seq 558 nt   +upstreamnt  +downstreamnt
atgctcgacagcactttcaagtccgccttcgaacgcaagccgaaggccgtttctctggaa
cttcagcacgaggtcgaacagttcctgtactgggaggcaaagctgctgacagatcgccgt
taccaggaatggttcgaccttctggccacggatctccgctactggatgccgatccgatcg
acccggatcatgcgcgaagtcgctcaggaatacaccgatgagaacggtttcgcacatttc
gacgacaactggcacacgatgaagggtcgtatccgcaagatcatgtcggatgtgggctgg
tccgagaacccggcttcgcgccttcgctatctggtcggcaatgtgatgatcgtccccgaa
agcgacgacaccctcaatgtcgtctcggccgtgatggtctatcgcacgcggcaggaacgc
cagctcgacgttttcgcctgcgagcgccaggatgtcctgcgccgcgtcgctagcgaggcc
ggtttccagatcgcgagccgcaagatcctgatcgatcagagcaccatcctttccaacaac
ctcagcttcttcttctga

DBGET integrated database retrieval system