Pseudomonas glycinae: AWU82_22040 Help Entry AWU82_22040       CDS       T06994                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgy  Pseudomonas glycinae Pathway pgy01100   Metabolic pathways pgy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AWU82_22040    00074 Mycolic acid biosynthesis     AWU82_22040   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AWU82_22040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMQ85885 LinkDB All DBs Position complement(5605593..5605853) Genome browser AA seq 86 aa AA seqDB search MSDLNRDIKELIIDALGLEDISAEDIGDDQTLFGEGLGLDSVDALELGLAIQKKYGIKID ADAKDTRNHFSNVASLAAFVTAKQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctaaaccgtgacataaaagagctgatcatcgacgccctgggcctcgaagac atcagcgcagaggacatcggcgacgaccagacgctgtttggcgaaggcctgggcctggat tccgtcgacgctctggaactcggcctggcgatccagaaaaagtacggcatcaaaatcgac gccgacgccaaggacacccgcaaccatttctccaacgtggcgagccttgcggcgttcgtc acggcaaaacaggcagcttga

DBGET integrated database retrieval system