Mixta gaviniae: C2E15_08320 Help Entry C2E15_08320       CDS       T05418                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pgz  Mixta gaviniae Pathway pgz01100   Metabolic pathways pgz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pgz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2E15_08320    00074 Mycolic acid biosynthesis     C2E15_08320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2E15_08320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH EutQ Ribosomal_L50 DUF6952 Motif Other DBs NCBI-ProteinID:  AUX93085 UniProt:  A0A2L0IES4 LinkDB All DBs Position 1792999..1793235 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIISEQLGVKQEEVTNEKSFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINNHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatctccgagcagcttggcgttaagcag gaagaagtcaccaacgaaaaatctttcgttgaagatcttggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcactactgttcaggctgctattgattacatcaataaccatcaggcctaa

DBGET integrated database retrieval system