Pseudoalteromonas translucida TAC125: PSHAb0394 Help Entry PSHAb0394         CDS       T00282                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism pha  Pseudoalteromonas translucida TAC125 Pathway pha01100   Metabolic pathways pha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSHAb0394    00074 Mycolic acid biosynthesis     PSHAb0394   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSHAb0394 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding RST Motif Other DBs NCBI-ProteinID:  CAI89432 UniProt:  Q3IC48 LinkDB All DBs Position II:452947..453192 Genome browser AA seq 81 aa AA seqDB search MKTAAEIYDVLHGILENDFEIDPADINLDANLYQDLDLDSIDAVDLVVKLREITGKKIDP DAFKQVRTVQNVVSEIEKLVN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaaaaccgctgctgaaatttatgatgtattacacggcattttagaaaacgattttgag atagacccagccgacataaacctagacgccaacttatatcaagaccttgatttagacagc attgacgctgttgacttggtagtaaaactaagagaaatcaccggtaaaaaaattgatcct gatgcatttaagcaagtacgtactgtgcaaaatgtagttagcgaaatagaaaaactcgtt aactaa

DBGET integrated database retrieval system