Panicum hallii (Hall's panicgrass): 112873737 Help Entry 112873737         CDS       T07366                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism phai  Panicum hallii (Hall's panicgrass) Pathway phai04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:phai00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112873737  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:phai04121]     112873737    03400 DNA repair and recombination proteins [BR:phai03400]     112873737 Ubiquitin system [BR:phai04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      112873737    Cul5 complex      112873737 DNA repair and recombination proteins [BR:phai03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      112873737 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  112873737 NCBI-ProteinID:  XP_025792562 LinkDB All DBs Position 9:68865002..68867619 Genome browser AA seq 117 aa AA seqDB search MVGKGEAPAPREPEEEEEEDTGGVVKLISAEGFEFVIDKKAAMVSNTLRNMLTSPGGFSE TRQGEVRFPEISTHILEKICQYFYWSLHYSSGKETAEFPIEPEITLDLMMAANYLDT NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggtgggcaagggagaggccccggctccgcgtgagcccgaggaggaggaggaggaggac accggaggcgtcgtcaagctcatcagcgccgagggtttcgagttcgtcatcgacaagaag gcagccatggtctccaacaccctgcgcaacatgctcacatcgccaggcggcttctccgag acgcgccagggcgaggtccgcttcccggagatctctacccacatactcgagaagatctgc cagtacttctactggtcgctccattattccagtgggaaggagacggcggagtttccaatt gagcccgagataaccctggacctgatgatggcagcaaactacctggacacttga

DBGET integrated database retrieval system