Panicum hallii (Hall's panicgrass): 112874194 Help Entry 112874194         CDS       T07366                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism phai  Panicum hallii (Hall's panicgrass) Brite KEGG Orthology (KO) [BR:phai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:phai03041]     112874194   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:phai04052]     112874194 Spliceosome [BR:phai03041]  Complex B   Other components    Complex B specific factors     112874194 Cytokines and neuropeptides [BR:phai04052]  Neuropeptides   Unclassified    112874194 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Motif Other DBs NCBI-GeneID:  112874194 NCBI-ProteinID:  XP_025793179 LinkDB All DBs Position 1:complement(50214934..50215730) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKRLVAAQTGTRADKIRIQKWYTIYKDHITLADY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctgaacgaccgtctggggaagaaggtgcgcgtcaagtgcaacgag gacgacacgatcggcgacctgaagcggctggtggcggcgcagacggggacgcgcgccgac aagatccggatccagaagtggtacaccatctacaaggaccacatcaccctcgccgactac gagatccacgacggcatggggctcgagctctactacaactag

DBGET integrated database retrieval system