Panicum hallii (Hall's panicgrass): 112884074 Help Entry 112884074         CDS       T07366                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism phai  Panicum hallii (Hall's panicgrass) Pathway phai04145   Phagosome phai04148   Efferocytosis phai04517   IgSF CAM signaling phai04518   Integrin signaling phai04620   Toll-like receptor signaling pathway phai05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:phai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112884074    04518 Integrin signaling     112884074  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112884074    04148 Efferocytosis     112884074  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112884074  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112884074  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:phai04131]     112884074   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:phai04147]     112884074    04031 GTP-binding proteins [BR:phai04031]     112884074 Membrane trafficking [BR:phai04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112884074  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     112884074   Macropinocytosis    Ras GTPases     112884074  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     112884074 Exosome [BR:phai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112884074   Exosomal proteins of other body fluids (saliva and urine)    112884074   Exosomal proteins of colorectal cancer cells    112884074   Exosomal proteins of bladder cancer cells    112884074 GTP-binding proteins [BR:phai04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112884074 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  112884074 NCBI-ProteinID:  XP_025805176 LinkDB All DBs Position 3:14305106..14307777 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISRASYENVLKKWVPELRRFAPNVPVVLVGTKL DLRDHRAYLADHPGASTITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP PRRREAMPARRKSRRGSGCSIMNLMCGSTCAA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtgacggtgggcgacggcgcggtgggcaagacc tgcatgctcatctgctacaccagcaacaagttccccacggattacatccccacggtgttc gacaacttcagcgccaacgtctccgtggatggcaacatcgtcaacttgggcctctgggat actgctgggcaagaggactacagcagactgaggccactgagctacaggggcgcagacgtg ttcgtgctggcgttctccctgatcagcagggcgagctatgagaatgttcttaagaagtgg gtgccagagctgcgcagatttgcacccaatgttccagttgttcttgttgggaccaagtta gatctccgtgaccatagagcctaccttgctgaccatcccggagcttcaacaatcacaacg gcacagggtgaagaactgaggaagcagattggtgctgcagcttacatcgagtgcagttcc aaaacacagcagaatgtcaaggctgtctttgataccgccatcaaagtggtccttcagcct cctcggagaagggaggcaatgcctgccaggaggaaaagtaggcgtggctccggatgctct attatgaacctgatgtgtggcagcacgtgtgctgcttag

DBGET integrated database retrieval system