Panicum hallii (Hall's panicgrass): 112887877 Help Entry 112887877         CDS       T07366                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism phai  Panicum hallii (Hall's panicgrass) Pathway phai04016   MAPK signaling pathway - plant phai04070   Phosphatidylinositol signaling system phai04075   Plant hormone signal transduction phai04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:phai00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     112887877    04070 Phosphatidylinositol signaling system     112887877    04075 Plant hormone signal transduction     112887877  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     112887877  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:phai01009]     112887877   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:phai04131]     112887877    03036 Chromosome and associated proteins [BR:phai03036]     112887877   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:phai04147]     112887877 Protein phosphatases and associated proteins [BR:phai01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112887877 Membrane trafficking [BR:phai04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112887877 Chromosome and associated proteins [BR:phai03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112887877 Exosome [BR:phai04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112887877 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin FCaBP_EF-hand SPEF2_C MotA_activ SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  112887877 NCBI-ProteinID:  XP_025809951 LinkDB All DBs Position 3:15143730..15146109 Genome browser AA seq 149 aa AA seqDB search MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgagcagatcgcggagttcaaggaggcgttcagcctcttc gacaaggacggcgacggttgcatcactaccaaggagcttggaactgtgatgcgctccctt ggccagaaccctactgaagcagagctgcaggacatgatcaacgaggttgatgctgatggc aacgggaccatcgacttcccagagttcctgaacctgatggcaaggaagatgaaggacact gactctgaggaggagctcaaggaggctttccgcgtcttcgacaaggaccagaacggtttc atctcggctgctgagctccgccacgtcatgaccaaccttggtgagaagctgaccgatgag gaagtcgacgagatgatccgcgaggctgatgtggacggtgatggccagatcaactatgag gagtttgttaaggttatgatggccaagtga

DBGET integrated database retrieval system