Panicum hallii (Hall's panicgrass): 112897703 Help Entry 112897703         CDS       T07366                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism phai  Panicum hallii (Hall's panicgrass) Pathway phai03083   Polycomb repressive complex phai04120   Ubiquitin mediated proteolysis phai04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:phai00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112897703    04120 Ubiquitin mediated proteolysis     112897703   09126 Chromosome    03083 Polycomb repressive complex     112897703  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:phai04131]     112897703    04121 Ubiquitin system [BR:phai04121]     112897703    03036 Chromosome and associated proteins [BR:phai03036]     112897703 Membrane trafficking [BR:phai04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112897703 Ubiquitin system [BR:phai04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112897703    Cul7 complex      112897703 Chromosome and associated proteins [BR:phai03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112897703   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112897703 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Myb_DNA-binding Myb_DNA-bind_6 Motif Other DBs NCBI-GeneID:  112897703 NCBI-ProteinID:  XP_025821872 LinkDB All DBs Position 1:complement(47591016..47591432) Genome browser AA seq 138 aa AA seqDB search MAAFSATIKGMIDEGCAADGVVELPNVAAATLSRVLEHVERHFDSDDSHYPSSSFNPSDD DTLARFDEELVGVDNDTLFHLLQAANFLGIDKLLDLTCKAVAEQMRGRTPDEIREKFHSV NDYTKSLVGVRSRLNSIV NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggccgccttctcggccacgatcaagggcatgatcgacgaggggtgcgccgccgacggc gtcgtggagctcccgaacgtcgccgccgccacgctttcccgcgtcctcgagcacgtcgag aggcacttcgactcggacgactcccactacccctcctcctccttcaaccccagcgacgac gacaccctggcccgcttcgacgaggagcttgtcggcgtcgacaacgacaccctcttccac ctcctgcaggcggccaacttcctcggcatcgacaagctgctggacctgacgtgcaaggcg gtggcggagcagatgcgcgggaggacgcccgacgagatccgcgagaagttccacagcgtc aacgactacaccaagtcactcgtgggcgttcgatcgagattgaactcgatcgtgtga

DBGET integrated database retrieval system