Panicum hallii (Hall's panicgrass): 112902928 Help Entry 112902928         CDS       T07366                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism phai  Panicum hallii (Hall's panicgrass) Brite KEGG Orthology (KO) [BR:phai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:phai03041]     112902928   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:phai04052]     112902928 Spliceosome [BR:phai03041]  Complex B   Other components    Complex B specific factors     112902928 Cytokines and neuropeptides [BR:phai04052]  Neuropeptides   Unclassified    112902928 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Motif Other DBs NCBI-GeneID:  112902928 NCBI-ProteinID:  XP_025827909 LinkDB All DBs Position 8:1928679..1930989 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctgaatgaccgcctggggaagaaggtgcgggtcaagtgcaacgag gacgacaccatcggcgacctcaagaagctggttgcggcgcagacggggacgcgccccgag aagatccgcatccagaagtggtacaacatctacaaggaccacatcaccctcaaggactac gagatccacgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system