Parasphingorhabdus halotolerans: HF685_03310 Help Entry HF685_03310       CDS       T07423                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phao  Parasphingorhabdus halotolerans Pathway phao01100   Metabolic pathways phao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HF685_03310    00074 Mycolic acid biosynthesis     HF685_03310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HF685_03310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QJB68450 UniProt:  A0A6H2DJ84 LinkDB All DBs Position 690152..690424 Genome browser AA seq 90 aa AA seqDB search MSENIDLTPEAAVRAVMRDILGLDAEQVAEFTAETELFGALPELDSMAVAALLTELEDRL DIMIEDDEVDGELFETFGNLVAFTEMKVAE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtccgaaaatattgatctgacgccggaagctgcagttcgtgctgtgatgcgggatatc ttggggttagatgccgaacaagtagccgaatttactgctgaaaccgagctctttggagcc ctgcccgaacttgacagcatggccgttgccgccttgctaacggaattggaagaccgactg gatatcatgatcgaagatgacgaagttgatggcgaactgtttgaaactttcggcaatctt gtcgcttttactgaaatgaaagtggctgagtga

DBGET integrated database retrieval system