Parasphingorhabdus halotolerans: HF685_06605 Help Entry HF685_06605       CDS       T07423                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism phao  Parasphingorhabdus halotolerans Pathway phao00190   Oxidative phosphorylation phao01100   Metabolic pathways Module phao_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:phao00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HF685_06605  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:phao00194]     HF685_06605 Photosynthesis proteins [BR:phao00194]  Photosystem and electron transport system   F-type ATPase [OT]    HF685_06605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QJB68991 UniProt:  A0A6H2DML0 LinkDB All DBs Position 1375397..1375654 Genome browser AA seq 85 aa AA seqDB search MANLHFELVTPEKLVRSEDVFMVVVPGTEGDFGVLAKHAPVMSTIRDADLVIYATEGGTP ETITVQGGFAEVNEAGLTVLAEAVS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcaaacctacatttcgaactcgtaacccctgaaaagctcgtccggtcggaagatgta ttcatggtggttgtgcccggtacagagggcgactttggtgtgctcgccaaacacgcgccg gtgatgtcgacgatccgtgatgccgatctggttatttatgccacagaaggcggtacgcct gaaacaatcaccgttcagggcggctttgcagaagtaaacgaagcgggtctgacggtattg gcagaggccgtttcctga

DBGET integrated database retrieval system