KEGG   Parasphingorhabdus halotolerans: HF685_08530
Entry
HF685_08530       CDS       T07423                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
phao  Parasphingorhabdus halotolerans
Pathway
phao00770  Pantothenate and CoA biosynthesis
phao01100  Metabolic pathways
phao01240  Biosynthesis of cofactors
Module
phao_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:phao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HF685_08530 (coaD)
Enzymes [BR:phao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     HF685_08530 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: QJB69321
UniProt: A0A6H2DNJ2
LinkDB
Position
complement(1753207..1753710)
AA seq 167 aa
MRIGIYPGTFDPITLGHMDIIKRGTALVDKLVIGVTTNPSKSPMFSDEERLDMVRRETAH
LGDAVEVVGFNSLLMKFAEKQRASVIVRGLRAVADFEYEYQMAGMNQQLNDDIETVFLMA
DVSLQPIASRLVKEIAMFGGEVKKFVTPKVAEEIVTRVNEIGLKGDQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaggattggcatttatccgggcacttttgacccgatcaccttgggtcatatggatata
atcaagcgcggaacggcgctggttgacaagctggttatcggtgtcaccaccaatccttcc
aaatctccgatgttttctgacgaggaacgtctcgatatggtgcgccgggaaaccgcgcat
ctgggcgatgccgtggaggtggtcgggtttaactcgctgctgatgaaatttgccgaaaaa
cagcgcgccagcgttatcgtgcgcggcctgcgtgctgttgccgattttgaatatgaatac
cagatggcaggcatgaaccagcaactgaatgatgatatcgagacggtgttcctgatggca
gatgtgtcgctgcaaccgattgcctcgcggctggtgaaagaaatcgcgatgttcggcggt
gaagttaaaaaattcgtgacccccaaagtggccgaagaaattgtcacacgcgttaacgag
attggtttgaagggcgatcaatag

DBGET integrated database retrieval system