KEGG   Phyllostomus hastatus (greater spear-nosed bat): 123804414
Entry
123804414         CDS       T07912                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
phas  Phyllostomus hastatus (greater spear-nosed bat)
Pathway
phas01521  EGFR tyrosine kinase inhibitor resistance
phas01522  Endocrine resistance
phas04010  MAPK signaling pathway
phas04012  ErbB signaling pathway
phas04014  Ras signaling pathway
phas04015  Rap1 signaling pathway
phas04062  Chemokine signaling pathway
phas04068  FoxO signaling pathway
phas04071  Sphingolipid signaling pathway
phas04072  Phospholipase D signaling pathway
phas04137  Mitophagy - animal
phas04140  Autophagy - animal
phas04150  mTOR signaling pathway
phas04151  PI3K-Akt signaling pathway
phas04210  Apoptosis
phas04211  Longevity regulating pathway
phas04213  Longevity regulating pathway - multiple species
phas04218  Cellular senescence
phas04360  Axon guidance
phas04370  VEGF signaling pathway
phas04371  Apelin signaling pathway
phas04540  Gap junction
phas04550  Signaling pathways regulating pluripotency of stem cells
phas04625  C-type lectin receptor signaling pathway
phas04650  Natural killer cell mediated cytotoxicity
phas04660  T cell receptor signaling pathway
phas04662  B cell receptor signaling pathway
phas04664  Fc epsilon RI signaling pathway
phas04714  Thermogenesis
phas04720  Long-term potentiation
phas04722  Neurotrophin signaling pathway
phas04725  Cholinergic synapse
phas04726  Serotonergic synapse
phas04730  Long-term depression
phas04810  Regulation of actin cytoskeleton
phas04910  Insulin signaling pathway
phas04912  GnRH signaling pathway
phas04915  Estrogen signaling pathway
phas04916  Melanogenesis
phas04917  Prolactin signaling pathway
phas04919  Thyroid hormone signaling pathway
phas04921  Oxytocin signaling pathway
phas04926  Relaxin signaling pathway
phas04929  GnRH secretion
phas04933  AGE-RAGE signaling pathway in diabetic complications
phas04935  Growth hormone synthesis, secretion and action
phas05010  Alzheimer disease
phas05022  Pathways of neurodegeneration - multiple diseases
phas05034  Alcoholism
phas05160  Hepatitis C
phas05161  Hepatitis B
phas05163  Human cytomegalovirus infection
phas05165  Human papillomavirus infection
phas05166  Human T-cell leukemia virus 1 infection
phas05167  Kaposi sarcoma-associated herpesvirus infection
phas05170  Human immunodeficiency virus 1 infection
phas05200  Pathways in cancer
phas05203  Viral carcinogenesis
phas05205  Proteoglycans in cancer
phas05206  MicroRNAs in cancer
phas05207  Chemical carcinogenesis - receptor activation
phas05208  Chemical carcinogenesis - reactive oxygen species
phas05210  Colorectal cancer
phas05211  Renal cell carcinoma
phas05213  Endometrial cancer
phas05214  Glioma
phas05215  Prostate cancer
phas05216  Thyroid cancer
phas05218  Melanoma
phas05219  Bladder cancer
phas05220  Chronic myeloid leukemia
phas05221  Acute myeloid leukemia
phas05223  Non-small cell lung cancer
phas05224  Breast cancer
phas05225  Hepatocellular carcinoma
phas05226  Gastric cancer
phas05230  Central carbon metabolism in cancer
phas05231  Choline metabolism in cancer
phas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
phas05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:phas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    123804414 (NRAS)
   04012 ErbB signaling pathway
    123804414 (NRAS)
   04014 Ras signaling pathway
    123804414 (NRAS)
   04015 Rap1 signaling pathway
    123804414 (NRAS)
   04370 VEGF signaling pathway
    123804414 (NRAS)
   04371 Apelin signaling pathway
    123804414 (NRAS)
   04068 FoxO signaling pathway
    123804414 (NRAS)
   04072 Phospholipase D signaling pathway
    123804414 (NRAS)
   04071 Sphingolipid signaling pathway
    123804414 (NRAS)
   04151 PI3K-Akt signaling pathway
    123804414 (NRAS)
   04150 mTOR signaling pathway
    123804414 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    123804414 (NRAS)
   04137 Mitophagy - animal
    123804414 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    123804414 (NRAS)
   04218 Cellular senescence
    123804414 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    123804414 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    123804414 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    123804414 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    123804414 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    123804414 (NRAS)
   04660 T cell receptor signaling pathway
    123804414 (NRAS)
   04662 B cell receptor signaling pathway
    123804414 (NRAS)
   04664 Fc epsilon RI signaling pathway
    123804414 (NRAS)
   04062 Chemokine signaling pathway
    123804414 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    123804414 (NRAS)
   04929 GnRH secretion
    123804414 (NRAS)
   04912 GnRH signaling pathway
    123804414 (NRAS)
   04915 Estrogen signaling pathway
    123804414 (NRAS)
   04917 Prolactin signaling pathway
    123804414 (NRAS)
   04921 Oxytocin signaling pathway
    123804414 (NRAS)
   04926 Relaxin signaling pathway
    123804414 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    123804414 (NRAS)
   04919 Thyroid hormone signaling pathway
    123804414 (NRAS)
   04916 Melanogenesis
    123804414 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    123804414 (NRAS)
   04726 Serotonergic synapse
    123804414 (NRAS)
   04720 Long-term potentiation
    123804414 (NRAS)
   04730 Long-term depression
    123804414 (NRAS)
   04722 Neurotrophin signaling pathway
    123804414 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    123804414 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    123804414 (NRAS)
   04213 Longevity regulating pathway - multiple species
    123804414 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    123804414 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123804414 (NRAS)
   05206 MicroRNAs in cancer
    123804414 (NRAS)
   05205 Proteoglycans in cancer
    123804414 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    123804414 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    123804414 (NRAS)
   05203 Viral carcinogenesis
    123804414 (NRAS)
   05230 Central carbon metabolism in cancer
    123804414 (NRAS)
   05231 Choline metabolism in cancer
    123804414 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    123804414 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    123804414 (NRAS)
   05225 Hepatocellular carcinoma
    123804414 (NRAS)
   05226 Gastric cancer
    123804414 (NRAS)
   05214 Glioma
    123804414 (NRAS)
   05216 Thyroid cancer
    123804414 (NRAS)
   05221 Acute myeloid leukemia
    123804414 (NRAS)
   05220 Chronic myeloid leukemia
    123804414 (NRAS)
   05218 Melanoma
    123804414 (NRAS)
   05211 Renal cell carcinoma
    123804414 (NRAS)
   05219 Bladder cancer
    123804414 (NRAS)
   05215 Prostate cancer
    123804414 (NRAS)
   05213 Endometrial cancer
    123804414 (NRAS)
   05224 Breast cancer
    123804414 (NRAS)
   05223 Non-small cell lung cancer
    123804414 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    123804414 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    123804414 (NRAS)
   05161 Hepatitis B
    123804414 (NRAS)
   05160 Hepatitis C
    123804414 (NRAS)
   05163 Human cytomegalovirus infection
    123804414 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    123804414 (NRAS)
   05165 Human papillomavirus infection
    123804414 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123804414 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    123804414 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    123804414 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123804414 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    123804414 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    123804414 (NRAS)
   01522 Endocrine resistance
    123804414 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phas04131]
    123804414 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phas04147]
    123804414 (NRAS)
   04031 GTP-binding proteins [BR:phas04031]
    123804414 (NRAS)
Membrane trafficking [BR:phas04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    123804414 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    123804414 (NRAS)
Exosome [BR:phas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   123804414 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   123804414 (NRAS)
  Exosomal proteins of breast cancer cells
   123804414 (NRAS)
  Exosomal proteins of colorectal cancer cells
   123804414 (NRAS)
GTP-binding proteins [BR:phas04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    123804414 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 123804414
NCBI-ProteinID: XP_045672646
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca
atccagctaatccagaaccactttgtagatgaatatgaccccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgctggacatactggacacagctgga
caagaggagtacagtgccatgcgagaccagtacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctgtacagggaacagatt
aagcgagtcaaagactcagatgacgtacctatggtgctagtgggaaacaagtgtgacctg
ccaacgaggacagttgacacaaaacaagcccacgaactggccaagagttatgggatccca
ttcattgagacctcagccaagaccagacagggtgtcgaagatgccttttacacactggtg
agagaaatccgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggc
tgcatggggctgccctgtgtggtgatgtaa

DBGET integrated database retrieval system