KEGG   Phyllostomus hastatus (greater spear-nosed bat): 123821009
Entry
123821009         CDS       T07912                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
phas  Phyllostomus hastatus (greater spear-nosed bat)
Pathway
phas04014  Ras signaling pathway
phas04015  Rap1 signaling pathway
phas04020  Calcium signaling pathway
phas04022  cGMP-PKG signaling pathway
phas04024  cAMP signaling pathway
phas04070  Phosphatidylinositol signaling system
phas04114  Oocyte meiosis
phas04218  Cellular senescence
phas04261  Adrenergic signaling in cardiomyocytes
phas04270  Vascular smooth muscle contraction
phas04371  Apelin signaling pathway
phas04625  C-type lectin receptor signaling pathway
phas04713  Circadian entrainment
phas04720  Long-term potentiation
phas04722  Neurotrophin signaling pathway
phas04728  Dopaminergic synapse
phas04740  Olfactory transduction
phas04744  Phototransduction
phas04750  Inflammatory mediator regulation of TRP channels
phas04910  Insulin signaling pathway
phas04912  GnRH signaling pathway
phas04915  Estrogen signaling pathway
phas04916  Melanogenesis
phas04921  Oxytocin signaling pathway
phas04922  Glucagon signaling pathway
phas04924  Renin secretion
phas04925  Aldosterone synthesis and secretion
phas04970  Salivary secretion
phas04971  Gastric acid secretion
phas05010  Alzheimer disease
phas05012  Parkinson disease
phas05022  Pathways of neurodegeneration - multiple diseases
phas05031  Amphetamine addiction
phas05034  Alcoholism
phas05133  Pertussis
phas05152  Tuberculosis
phas05163  Human cytomegalovirus infection
phas05167  Kaposi sarcoma-associated herpesvirus infection
phas05170  Human immunodeficiency virus 1 infection
phas05200  Pathways in cancer
phas05214  Glioma
phas05417  Lipid and atherosclerosis
phas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:phas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    123821009
   04015 Rap1 signaling pathway
    123821009
   04371 Apelin signaling pathway
    123821009
   04020 Calcium signaling pathway
    123821009
   04070 Phosphatidylinositol signaling system
    123821009
   04024 cAMP signaling pathway
    123821009
   04022 cGMP-PKG signaling pathway
    123821009
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    123821009
   04218 Cellular senescence
    123821009
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    123821009
  09152 Endocrine system
   04910 Insulin signaling pathway
    123821009
   04922 Glucagon signaling pathway
    123821009
   04912 GnRH signaling pathway
    123821009
   04915 Estrogen signaling pathway
    123821009
   04921 Oxytocin signaling pathway
    123821009
   04916 Melanogenesis
    123821009
   04924 Renin secretion
    123821009
   04925 Aldosterone synthesis and secretion
    123821009
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    123821009
   04270 Vascular smooth muscle contraction
    123821009
  09154 Digestive system
   04970 Salivary secretion
    123821009
   04971 Gastric acid secretion
    123821009
  09156 Nervous system
   04728 Dopaminergic synapse
    123821009
   04720 Long-term potentiation
    123821009
   04722 Neurotrophin signaling pathway
    123821009
  09157 Sensory system
   04744 Phototransduction
    123821009
   04740 Olfactory transduction
    123821009
   04750 Inflammatory mediator regulation of TRP channels
    123821009
  09159 Environmental adaptation
   04713 Circadian entrainment
    123821009
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123821009
  09162 Cancer: specific types
   05214 Glioma
    123821009
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    123821009
   05163 Human cytomegalovirus infection
    123821009
   05167 Kaposi sarcoma-associated herpesvirus infection
    123821009
  09171 Infectious disease: bacterial
   05133 Pertussis
    123821009
   05152 Tuberculosis
    123821009
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123821009
   05012 Parkinson disease
    123821009
   05022 Pathways of neurodegeneration - multiple diseases
    123821009
  09165 Substance dependence
   05031 Amphetamine addiction
    123821009
   05034 Alcoholism
    123821009
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123821009
   05418 Fluid shear stress and atherosclerosis
    123821009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phas01009]
    123821009
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phas04131]
    123821009
   03036 Chromosome and associated proteins [BR:phas03036]
    123821009
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phas04147]
    123821009
Protein phosphatases and associated proteins [BR:phas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     123821009
Membrane trafficking [BR:phas04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    123821009
Chromosome and associated proteins [BR:phas03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     123821009
Exosome [BR:phas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   123821009
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EF-hand_9 EF-hand_FSTL1 EH SPARC_Ca_bdg EFhand_Ca_insen TerB EF_EFCAB10_C DUF1103 UPF0154 EF-hand_EFHB_C Dockerin_1 EF-hand_11 SurA_N_3 dCache_2 CUSTOS DUF5580_M EAP30
Other DBs
NCBI-GeneID: 123821009
NCBI-ProteinID: XP_045698198
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQIAEFKAAFSLFDKDGDGTITTKELGTVTRSLGQNPTEAELQDMINEVDADG
NDTIDFPEFLAMMARKMKDTDSEEEIREALRVFNKDGNGYITAAELHHVMTNLGENLTDE
EVDEMIREADIDGDGQVNYKEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccagctgactgaagagcagattgcagaattcaaagcagctttttcactattt
gacaaggatggtgatgggactattacaacaaaggaattgggaactgtaacaaggtctctt
gggcagaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt
aatgacacaattgacttcccagaatttctggcaatgatggcaagaaaaatgaaagacaca
gacagtgaagaagaaattagagaagcattacgtgtgtttaataaggatggcaatggctac
atcactgcagcagagcttcaccatgtgatgacaaaccttggagagaatttaacagatgaa
gaggttgatgaaatgatcagagaagcagatattgatggtgatggtcaagtaaactataaa
gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system