KEGG   Phyllostomus hastatus (greater spear-nosed bat): 123825523
Entry
123825523         CDS       T07912                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
phas  Phyllostomus hastatus (greater spear-nosed bat)
Pathway
phas01521  EGFR tyrosine kinase inhibitor resistance
phas01522  Endocrine resistance
phas01524  Platinum drug resistance
phas04010  MAPK signaling pathway
phas04012  ErbB signaling pathway
phas04014  Ras signaling pathway
phas04015  Rap1 signaling pathway
phas04022  cGMP-PKG signaling pathway
phas04024  cAMP signaling pathway
phas04062  Chemokine signaling pathway
phas04066  HIF-1 signaling pathway
phas04068  FoxO signaling pathway
phas04071  Sphingolipid signaling pathway
phas04072  Phospholipase D signaling pathway
phas04114  Oocyte meiosis
phas04140  Autophagy - animal
phas04148  Efferocytosis
phas04150  mTOR signaling pathway
phas04151  PI3K-Akt signaling pathway
phas04210  Apoptosis
phas04218  Cellular senescence
phas04261  Adrenergic signaling in cardiomyocytes
phas04270  Vascular smooth muscle contraction
phas04350  TGF-beta signaling pathway
phas04360  Axon guidance
phas04370  VEGF signaling pathway
phas04371  Apelin signaling pathway
phas04380  Osteoclast differentiation
phas04510  Focal adhesion
phas04517  IgSF CAM signaling
phas04520  Adherens junction
phas04540  Gap junction
phas04550  Signaling pathways regulating pluripotency of stem cells
phas04611  Platelet activation
phas04613  Neutrophil extracellular trap formation
phas04620  Toll-like receptor signaling pathway
phas04621  NOD-like receptor signaling pathway
phas04625  C-type lectin receptor signaling pathway
phas04650  Natural killer cell mediated cytotoxicity
phas04657  IL-17 signaling pathway
phas04658  Th1 and Th2 cell differentiation
phas04659  Th17 cell differentiation
phas04660  T cell receptor signaling pathway
phas04662  B cell receptor signaling pathway
phas04664  Fc epsilon RI signaling pathway
phas04666  Fc gamma R-mediated phagocytosis
phas04668  TNF signaling pathway
phas04713  Circadian entrainment
phas04720  Long-term potentiation
phas04722  Neurotrophin signaling pathway
phas04723  Retrograde endocannabinoid signaling
phas04724  Glutamatergic synapse
phas04725  Cholinergic synapse
phas04726  Serotonergic synapse
phas04730  Long-term depression
phas04810  Regulation of actin cytoskeleton
phas04910  Insulin signaling pathway
phas04912  GnRH signaling pathway
phas04914  Progesterone-mediated oocyte maturation
phas04915  Estrogen signaling pathway
phas04916  Melanogenesis
phas04917  Prolactin signaling pathway
phas04919  Thyroid hormone signaling pathway
phas04921  Oxytocin signaling pathway
phas04926  Relaxin signaling pathway
phas04928  Parathyroid hormone synthesis, secretion and action
phas04929  GnRH secretion
phas04930  Type II diabetes mellitus
phas04933  AGE-RAGE signaling pathway in diabetic complications
phas04934  Cushing syndrome
phas04935  Growth hormone synthesis, secretion and action
phas04960  Aldosterone-regulated sodium reabsorption
phas05010  Alzheimer disease
phas05020  Prion disease
phas05022  Pathways of neurodegeneration - multiple diseases
phas05034  Alcoholism
phas05132  Salmonella infection
phas05133  Pertussis
phas05135  Yersinia infection
phas05140  Leishmaniasis
phas05142  Chagas disease
phas05145  Toxoplasmosis
phas05152  Tuberculosis
phas05160  Hepatitis C
phas05161  Hepatitis B
phas05163  Human cytomegalovirus infection
phas05164  Influenza A
phas05165  Human papillomavirus infection
phas05166  Human T-cell leukemia virus 1 infection
phas05167  Kaposi sarcoma-associated herpesvirus infection
phas05170  Human immunodeficiency virus 1 infection
phas05171  Coronavirus disease - COVID-19
phas05200  Pathways in cancer
phas05203  Viral carcinogenesis
phas05205  Proteoglycans in cancer
phas05206  MicroRNAs in cancer
phas05207  Chemical carcinogenesis - receptor activation
phas05208  Chemical carcinogenesis - reactive oxygen species
phas05210  Colorectal cancer
phas05211  Renal cell carcinoma
phas05212  Pancreatic cancer
phas05213  Endometrial cancer
phas05214  Glioma
phas05215  Prostate cancer
phas05216  Thyroid cancer
phas05218  Melanoma
phas05219  Bladder cancer
phas05220  Chronic myeloid leukemia
phas05221  Acute myeloid leukemia
phas05223  Non-small cell lung cancer
phas05224  Breast cancer
phas05225  Hepatocellular carcinoma
phas05226  Gastric cancer
phas05230  Central carbon metabolism in cancer
phas05231  Choline metabolism in cancer
phas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
phas05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:phas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    123825523 (MAPK3)
   04012 ErbB signaling pathway
    123825523 (MAPK3)
   04014 Ras signaling pathway
    123825523 (MAPK3)
   04015 Rap1 signaling pathway
    123825523 (MAPK3)
   04350 TGF-beta signaling pathway
    123825523 (MAPK3)
   04370 VEGF signaling pathway
    123825523 (MAPK3)
   04371 Apelin signaling pathway
    123825523 (MAPK3)
   04668 TNF signaling pathway
    123825523 (MAPK3)
   04066 HIF-1 signaling pathway
    123825523 (MAPK3)
   04068 FoxO signaling pathway
    123825523 (MAPK3)
   04072 Phospholipase D signaling pathway
    123825523 (MAPK3)
   04071 Sphingolipid signaling pathway
    123825523 (MAPK3)
   04024 cAMP signaling pathway
    123825523 (MAPK3)
   04022 cGMP-PKG signaling pathway
    123825523 (MAPK3)
   04151 PI3K-Akt signaling pathway
    123825523 (MAPK3)
   04150 mTOR signaling pathway
    123825523 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    123825523 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    123825523 (MAPK3)
   04148 Efferocytosis
    123825523 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    123825523 (MAPK3)
   04210 Apoptosis
    123825523 (MAPK3)
   04218 Cellular senescence
    123825523 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    123825523 (MAPK3)
   04520 Adherens junction
    123825523 (MAPK3)
   04540 Gap junction
    123825523 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    123825523 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    123825523 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    123825523 (MAPK3)
   04613 Neutrophil extracellular trap formation
    123825523 (MAPK3)
   04620 Toll-like receptor signaling pathway
    123825523 (MAPK3)
   04621 NOD-like receptor signaling pathway
    123825523 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    123825523 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    123825523 (MAPK3)
   04660 T cell receptor signaling pathway
    123825523 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    123825523 (MAPK3)
   04659 Th17 cell differentiation
    123825523 (MAPK3)
   04657 IL-17 signaling pathway
    123825523 (MAPK3)
   04662 B cell receptor signaling pathway
    123825523 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    123825523 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    123825523 (MAPK3)
   04062 Chemokine signaling pathway
    123825523 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    123825523 (MAPK3)
   04929 GnRH secretion
    123825523 (MAPK3)
   04912 GnRH signaling pathway
    123825523 (MAPK3)
   04915 Estrogen signaling pathway
    123825523 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    123825523 (MAPK3)
   04917 Prolactin signaling pathway
    123825523 (MAPK3)
   04921 Oxytocin signaling pathway
    123825523 (MAPK3)
   04926 Relaxin signaling pathway
    123825523 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    123825523 (MAPK3)
   04919 Thyroid hormone signaling pathway
    123825523 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    123825523 (MAPK3)
   04916 Melanogenesis
    123825523 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    123825523 (MAPK3)
   04270 Vascular smooth muscle contraction
    123825523 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    123825523 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    123825523 (MAPK3)
   04725 Cholinergic synapse
    123825523 (MAPK3)
   04726 Serotonergic synapse
    123825523 (MAPK3)
   04720 Long-term potentiation
    123825523 (MAPK3)
   04730 Long-term depression
    123825523 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    123825523 (MAPK3)
   04722 Neurotrophin signaling pathway
    123825523 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    123825523 (MAPK3)
   04380 Osteoclast differentiation
    123825523 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    123825523 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123825523 (MAPK3)
   05206 MicroRNAs in cancer
    123825523 (MAPK3)
   05205 Proteoglycans in cancer
    123825523 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    123825523 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    123825523 (MAPK3)
   05203 Viral carcinogenesis
    123825523 (MAPK3)
   05230 Central carbon metabolism in cancer
    123825523 (MAPK3)
   05231 Choline metabolism in cancer
    123825523 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    123825523 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    123825523 (MAPK3)
   05212 Pancreatic cancer
    123825523 (MAPK3)
   05225 Hepatocellular carcinoma
    123825523 (MAPK3)
   05226 Gastric cancer
    123825523 (MAPK3)
   05214 Glioma
    123825523 (MAPK3)
   05216 Thyroid cancer
    123825523 (MAPK3)
   05221 Acute myeloid leukemia
    123825523 (MAPK3)
   05220 Chronic myeloid leukemia
    123825523 (MAPK3)
   05218 Melanoma
    123825523 (MAPK3)
   05211 Renal cell carcinoma
    123825523 (MAPK3)
   05219 Bladder cancer
    123825523 (MAPK3)
   05215 Prostate cancer
    123825523 (MAPK3)
   05213 Endometrial cancer
    123825523 (MAPK3)
   05224 Breast cancer
    123825523 (MAPK3)
   05223 Non-small cell lung cancer
    123825523 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    123825523 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    123825523 (MAPK3)
   05161 Hepatitis B
    123825523 (MAPK3)
   05160 Hepatitis C
    123825523 (MAPK3)
   05171 Coronavirus disease - COVID-19
    123825523 (MAPK3)
   05164 Influenza A
    123825523 (MAPK3)
   05163 Human cytomegalovirus infection
    123825523 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    123825523 (MAPK3)
   05165 Human papillomavirus infection
    123825523 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    123825523 (MAPK3)
   05135 Yersinia infection
    123825523 (MAPK3)
   05133 Pertussis
    123825523 (MAPK3)
   05152 Tuberculosis
    123825523 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    123825523 (MAPK3)
   05140 Leishmaniasis
    123825523 (MAPK3)
   05142 Chagas disease
    123825523 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123825523 (MAPK3)
   05020 Prion disease
    123825523 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    123825523 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    123825523 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123825523 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    123825523 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    123825523 (MAPK3)
   04934 Cushing syndrome
    123825523 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    123825523 (MAPK3)
   01524 Platinum drug resistance
    123825523 (MAPK3)
   01522 Endocrine resistance
    123825523 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phas01001]
    123825523 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phas03036]
    123825523 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phas04147]
    123825523 (MAPK3)
Enzymes [BR:phas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     123825523 (MAPK3)
Protein kinases [BR:phas01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   123825523 (MAPK3)
Chromosome and associated proteins [BR:phas03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     123825523 (MAPK3)
Exosome [BR:phas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   123825523 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 123825523
NCBI-ProteinID: XP_045704947
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAQGGGGGEPGGADGVGPGGPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHICKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGVLEAT
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcagcggcagctcaggggggcgggggcggggagcccggaggagcagatggggtc
ggcccggggggcccgggggaagtggagatagtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtatggcatggtcagctcagcctat
gaccacatatgcaagactcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacactgcgggaaatccagatcttgctgcgtttccgccacgagaatgtc
atcggcatccgagacattcttcgggcacctaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaac
gaccacgtctgctacttcctctaccagatcctgcggggcctcaagtatatccactcagcc
aacgtgctccaccgggatttaaagccctccaacctgctcatcaataccacctgcgacctt
aagatctgtgattttggcctggcccggatcgctgatcctgaacatgaccacactggcttc
ctgacagaatacgtggccacacgctggtaccgggccccagagatcatgcttaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatc
ctgggctccccgtcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtccctgccttccaagaccaaggtggcctgggccaagctttttcccaaatcagac
tccaaagcccttgacctgctggaccggatgttgacctttaaccccaataagcggatcaca
gtggaagaagccttggctcacccctacctggagcagtactacgacccaacagatgagccg
gtggctgaggaacctttcacctttgacatggagctggatgatctacccaaggagcggctg
aaggagctcatattccaggagacagcccgcttccagcctggggtgctggaggccacctaa

DBGET integrated database retrieval system