Phenylobacterium parvum: HYN04_07160 Help Entry HYN04_07160       CDS       T05485                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism phb  Phenylobacterium parvum Brite KEGG Orthology (KO) [BR:phb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:phb03032]     HYN04_07160    03036 Chromosome and associated proteins [BR:phb03036]     HYN04_07160    03400 DNA repair and recombination proteins [BR:phb03400]     HYN04_07160 DNA replication proteins [BR:phb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HYN04_07160 Chromosome and associated proteins [BR:phb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HYN04_07160 DNA repair and recombination proteins [BR:phb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HYN04_07160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Peptidase_C23 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AWM77559 UniProt:  A0A2Z3HXL1 LinkDB All DBs Position complement(1491020..1491292) Genome browser AA seq 90 aa AA seqDB search MNKAELVAAVSEGSGLSTSQVRVALDSILDTVTSALAEGQEVRLVGFGSFAAAFRPAGPA RNPRTGEAVRRPASRTVRFRAGEGLRRALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggccgagctggtcgcagcggtctctgagggctcggggctctctacaagccag gtgcgggtcgccctggactccatcctcgacaccgtcacgtccgcccttgccgagggccag gaagtccgtctggtcggctttggcagtttcgcggcggccttccgtccggccggaccggcg cgcaacccccgcaccggtgaggcggtccgaaggcccgcttcccgcaccgtccggttccgg gccggggaggggctaagacgcgccctcaactga

DBGET integrated database retrieval system