Prevotella herbatica: prwr041_05580 Help Entry prwr041_05580     CDS       T08008                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pher  Prevotella herbatica Pathway pher00020   Citrate cycle (TCA cycle) pher00720   Other carbon fixation pathways pher01100   Metabolic pathways pher01110   Biosynthesis of secondary metabolites pher01120   Microbial metabolism in diverse environments pher01200   Carbon metabolism pher01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pher00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     prwr041_05580   09102 Energy metabolism    00720 Other carbon fixation pathways     prwr041_05580 Enzymes [BR:pher01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      prwr041_05580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_4 LdpA_Fe-S-bd Fer4_16 Fer4_17 Fer4_15 Fer4_8 Fer4_3 Fer4_22 Fer4_13 Motif Other DBs NCBI-ProteinID:  BCS84665 UniProt:  A0ABN6EHP8 LinkDB All DBs Position 749971..750201 Genome browser AA seq 76 aa AA seqDB search MGKILGAVVINEDRCKGCALCVDACPKDVLALAGRKVNVHGYPYVEAIKADDCIGCASCG IVCPDGCITVYRKKLD NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgggaaaaatattaggtgctgttgttatcaacgaagacagatgcaagggctgcgcactt tgcgtagacgcttgtcctaaagacgttttagcattagcaggaagaaaagtcaacgttcac ggttatccttacgttgaagcaattaaagccgatgactgcatcggatgtgcttcatgtgga attgtatgccctgatggctgcattaccgtttatcgtaaaaaattagactaa

DBGET integrated database retrieval system