Porcisia hertigi: 94288485 Help Entry 94288485          CDS       T10408                                  Symbol JKF63_02380 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism phet  Porcisia hertigi Pathway phet04145   Phagocytosis phet04517   IgSF CAM signaling phet04814   Motor proteins Brite KEGG Orthology (KO) [BR:phet00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     94288485 (JKF63_02380)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     94288485 (JKF63_02380)   09142 Cell motility    04814 Motor proteins     94288485 (JKF63_02380)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:phet03037]     94288485 (JKF63_02380)    04812 Cytoskeleton proteins [BR:phet04812]     94288485 (JKF63_02380) Cilium and associated proteins [BR:phet03037]  Motile cilia and associated proteins   Dynein arm    94288485 (JKF63_02380) Cytoskeleton proteins [BR:phet04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94288485 (JKF63_02380) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ectatomin Ig_TRS130_1st NtdA_N Peptidase_C3 Motif Other DBs NCBI-GeneID:  94288485 NCBI-ProteinID:  XP_067754565 UniProt:  A0A836I0W1 LinkDB All DBs Position 32:complement(<102641..>102916) Genome browser AA seq 91 aa AA seqDB search MFNNDHKATVKNADMPEDMQADAIEVTLQAMEKFNIEKDIAAYIKKEFDKKYQPTWHCIV GRNFGSFVTHDTHCFLYFYIGQVAVLLFKCG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgttcaacaacgaccacaaggctacggtgaagaatgccgacatgccggaggacatgcag gcggacgcgattgaagtgacgctgcaggcaatggagaagttcaacattgagaaggacatc gctgcgtacatcaagaaggagttcgacaagaagtaccagccaacttggcattgcattgtg ggccgcaacttcggcagcttcgtgacgcacgatacgcactgcttcctgtacttctatatc ggccaggtcgcggtgctactcttcaagtgtgggtaa

DBGET integrated database retrieval system