Porcisia hertigi: 94290661 Help Entry 94290661          CDS       T10408                                  Symbol JKF63_04602 Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism phet  Porcisia hertigi Pathway phet03060   Protein export phet04141   Protein processing in endoplasmic reticulum phet04145   Phagosome Brite KEGG Orthology (KO) [BR:phet00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     94290661 (JKF63_04602)    04141 Protein processing in endoplasmic reticulum     94290661 (JKF63_04602)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     94290661 (JKF63_04602)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:phet04131]     94290661 (JKF63_04602)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:phet02044]     94290661 (JKF63_04602) Membrane trafficking [BR:phet04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     94290661 (JKF63_04602) Secretion system [BR:phet02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    94290661 (JKF63_04602) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  94290661 NCBI-ProteinID:  XP_067756605 UniProt:  A0A836IKJ2 LinkDB All DBs Position 25:378413..378622 Genome browser AA seq 69 aa AA seqDB search MDFLDDILFHPIVAFTKNSRMLVRKCQKPNYNEFTTAALAAVIGFLMMGFLGFFVKLVFI PINNVILGV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacttcctcgatgatatcttgttccaccccatcgtggctttcaccaagaacagccgc atgctggtgcgcaagtgtcagaagccaaactacaacgagttcacgacagccgcccttgcg gcagtgatcggcttcctcatgatgggcttcctcggcttctttgtgaagctcgtgttcatt ccaatcaacaacgtcattctcggtgtgtaa

DBGET integrated database retrieval system