KEGG   Ectopseudomonas hydrolytica: NLY38_21885
Entry
NLY38_21885       CDS       T08519                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
phf  Ectopseudomonas hydrolytica
Pathway
phf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:phf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NLY38_21885 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:phf03011]
    NLY38_21885 (rplR)
Ribosome [BR:phf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NLY38_21885 (rplR)
  Bacteria
    NLY38_21885 (rplR)
  Archaea
    NLY38_21885 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p TGS TM1506
Other DBs
NCBI-ProteinID: UTH31062
LinkDB
Position
complement(4650604..4650954)
AA seq 116 aa
MTDKKVTRLRRARKARLKMHELEAVRLCVYRSSQHIYAQVISADGSKVLASASTLDKALR
DGATGNVDAAKKVGQLVAERAKAAGVTQVAFDRSGFKYHGRVKALADAAREGGLEF
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaccgacaaaaaagttactcgtctgcgtcgcgctcgcaaagcacgcctgaaaatgcac
gagctcgaagccgtgcgtctgtgcgtgtatcgctcttcgcaacacatctacgcccaggtc
atttcggccgacggcagcaaggttctggccagcgcctcgaccttggacaaagcactgcgt
gatggcgccactggcaacgtcgacgccgccaagaaagtaggtcagctggttgccgagcgc
gcgaaagccgctggtgtgactcaggttgcattcgaccgttctggcttcaagtaccacggt
cgcgtcaaggcgctggccgatgctgctcgtgaaggcgggctggagttctaa

DBGET integrated database retrieval system