Pseudonocardia sp. HH130630-07: AFB00_21680 Help Entry AFB00_21680       CDS       T04486                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phh  Pseudonocardia sp. HH130630-07 Pathway phh00998   Biosynthesis of various antibiotics phh01100   Metabolic pathways phh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFB00_21680    00074 Mycolic acid biosynthesis     AFB00_21680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFB00_21680 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ANY08452 LinkDB All DBs Position complement(4563833..4564075) Genome browser AA seq 80 aa AA seqDB search MADNAEILSGLAEIVEEVAGIDTAEVTPEKSFVDDLDIDSLSMVEIAVQAEDKFGAKIPD DQLAELKTVGDAVDFISKHQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggctgacaacgccgagatcctgtccggcctggccgagatcgtcgaggaggtcgccggc atcgacaccgccgaggtgaccccggagaagtcgttcgtggacgacctggacatcgactcg ctgtcgatggtggagatcgccgtgcaggccgaggacaagttcggcgcgaagatcccggac gaccagctggccgagctgaagaccgtcggcgacgccgtcgacttcatctccaagcaccag tga

DBGET integrated database retrieval system