Pseudonocardia sp. HH130630-07: AFB00_31135 Help Entry AFB00_31135       CDS       T04486                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism phh  Pseudonocardia sp. HH130630-07 Pathway phh00253   Tetracycline biosynthesis phh01056   Biosynthesis of type II polyketide backbone phh01100   Metabolic pathways phh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phh00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     AFB00_31135    00253 Tetracycline biosynthesis     AFB00_31135  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:phh01004]     AFB00_31135    01008 Polyketide biosynthesis proteins [BR:phh01008]     AFB00_31135 Lipid biosynthesis proteins [BR:phh01004]  Polyketide synthase   Component type    AFB00_31135 Polyketide biosynthesis proteins [BR:phh01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      AFB00_31135     Nonaketide PKS      AFB00_31135     Decaketide PKS      AFB00_31135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANY10847 UniProt:  A0A1B1ZYJ9 LinkDB All DBs Position pLS2-2:77990..78241 Genome browser AA seq 83 aa AA seqDB search MSVLTLPELRELLIDAAGATDAGDTDGFGDQAFDELGYDSLALMQSAAVLKRRHGVEIPE DVLGTLTTPNEMLAFVNSARSVG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtccgttctgaccctgcccgaactgcgtgagctgctcatcgatgccgccggcgcgaca gacgccggcgacacggacggattcggcgaccaggcgttcgacgagctcggctacgactcg ctggccctgatgcagtccgccgccgtgctcaagcgccgccacggcgtcgagattccggag gacgtcctcggcacgctcaccacaccgaacgagatgctcgcgttcgtcaactcggcgcgg tccgtgggatga

DBGET integrated database retrieval system