Prevotella histicola: J5A62_03165 Help Entry J5A62_03165       CDS       T07498                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism phis  Prevotella histicola Pathway phis00020   Citrate cycle (TCA cycle) phis00720   Other carbon fixation pathways phis01100   Metabolic pathways phis01110   Biosynthesis of secondary metabolites phis01120   Microbial metabolism in diverse environments phis01200   Carbon metabolism phis01210   2-Oxocarboxylic acid metabolism Module phis_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:phis00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     J5A62_03165   09102 Energy metabolism    00720 Other carbon fixation pathways     J5A62_03165 Enzymes [BR:phis01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      J5A62_03165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_2 Fer4_7 Fer4_6 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_17 Fer4_15 Fer4_3 Fer4_8 Fer4_22 Fer4_13 Chordopox_G2 DUF326 Motif Other DBs NCBI-ProteinID:  QUB84359 LinkDB All DBs Position 1:813007..813240 Genome browser AA seq 77 aa AA seqDB search MSKMKGAIVVNTDRCKGCQLCIVACPKDVIALAQKKVNVHGYPYVESAVPDNCIGCAACA TVCPDGCITVYRKKVEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagatgaaaggtgccatcgtagtgaacactgatcggtgcaagggatgccagttg tgtatcgttgcatgtccgaaagatgtgattgccctggctcagaaaaaagttaatgtccac ggatatccgtatgtagaatcagctgttcccgataattgtatcggatgtgctgcttgtgca actgtttgtccagatggttgtattacggtttatcgtaagaaagtggaggaataa

DBGET integrated database retrieval system