Paenalcaligenes hominis: PAEH1_05080 Help Entry PAEH1_05080       CDS       T04704                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phn  Paenalcaligenes hominis Pathway phn00998   Biosynthesis of various antibiotics phn01100   Metabolic pathways phn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PAEH1_05080    00074 Mycolic acid biosynthesis     PAEH1_05080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PAEH1_05080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 DUF1896 HLH EutQ Motif Other DBs NCBI-ProteinID:  AQS51104 UniProt:  A0A1U9JZD2 LinkDB All DBs Position complement(999671..999910) Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAVNYINANSEQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgtaaacgaa gccgagatcaagaacgaatcttcttttcttgacgacctcggtgccgactcgctcgacatg gtcgagctcgtgatggcgctcgaagacgaattcgaaaccgaaatcccagacgaagaagct gagaaaatcacgacggttcagcaagctgttaactacattaacgctaacagcgagcagtaa

DBGET integrated database retrieval system