KEGG   Paracoccus homiensis: ACLISE_05500
Entry
ACLISE_05500      CDS       T11345                                 
Symbol
ssb
Name
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
phoi  Paracoccus homiensis
Pathway
phoi03030  DNA replication
phoi03430  Mismatch repair
phoi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:phoi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ACLISE_05500 (ssb)
   03430 Mismatch repair
    ACLISE_05500 (ssb)
   03440 Homologous recombination
    ACLISE_05500 (ssb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:phoi03032]
    ACLISE_05500 (ssb)
   03400 DNA repair and recombination proteins [BR:phoi03400]
    ACLISE_05500 (ssb)
   03029 Mitochondrial biogenesis [BR:phoi03029]
    ACLISE_05500 (ssb)
DNA replication proteins [BR:phoi03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    ACLISE_05500 (ssb)
DNA repair and recombination proteins [BR:phoi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     ACLISE_05500 (ssb)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    ACLISE_05500 (ssb)
Mitochondrial biogenesis [BR:phoi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    ACLISE_05500 (ssb)
SSDB
Other DBs
NCBI-ProteinID: XMR59865
LinkDB
Position
complement(1074498..1075004)
AA seq 168 aa
MAGSVNKVILIGNLGRDPEIRTFQNGGKVANLRIATSEQWKDRNTGERREKTEWHSVAIM
SEGLVNVVERFLKKGSKVYVEGQLETRKWQDQSGQDRYSTEVVLRGFGGTLQMLDGRGEG
GPGGGGGRDGGGYGGGSGGGYDDYRGGGSGGGAPSGGGRSDYDDEIPF
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcaggcagcgtcaacaaggtcattctgatcggcaatctgggccgcgaccccgagatc
cgcacgttccagaacggcggcaaggtcgccaacctgcgcatcgcgacctctgagcagtgg
aaagaccgcaacacgggcgagcgtcgcgaaaagaccgaatggcattcggtcgcgatcatg
tcggaagggctggtcaacgtggtcgagcggttcttgaaaaagggcagcaaggtctatgtc
gagggtcagctggaaacccgcaaatggcaggatcagtccggtcaggaccgctatagcacc
gaagtcgttctgcgcggctttggcggcacgctgcagatgctggatggccgcggcgaaggc
ggtcccggcggcggtggcggtcgtgacggcggcggctatggcggcggctcgggtggcggc
tatgacgattaccgcggcggcggttcgggcggcggcgccccctcgggtggcggtcgcagc
gattatgacgacgaaatcccgttctga

DBGET integrated database retrieval system