Phormidium sp. PBR-2020: JWS08_03205 Help Entry JWS08_03205       CDS       T07578                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism phor  Phormidium sp. PBR-2020 Pathway phor00190   Oxidative phosphorylation phor00195   Photosynthesis phor01100   Metabolic pathways Module phor_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:phor00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     JWS08_03205 (atpE)    00195 Photosynthesis     JWS08_03205 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:phor00194]     JWS08_03205 (atpE) Photosynthesis proteins [BR:phor00194]  Photosystem and electron transport system   F-type ATPase [OT]    JWS08_03205 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  UCJ12826 LinkDB All DBs Position 745463..745708 Genome browser AA seq 81 aa AA seqDB search MDSLTAAASVIAAALAVGLAAIGPGIGQGNAAGQALEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggattctttaacggctgctgcctctgttatcgctgctgctctcgcagtaggactcgct gcaattggaccgggaatcggtcaaggtaatgcggctggacaagctctcgaagggattgct cgtcagcccgaagcagaaggaaaaattcgcggaactttgctgctgagtttggcattcatg gaagcactaacgatttacggtttggtggttgcactggtgctgctgtttgctaaccccttc tcttag

DBGET integrated database retrieval system