Phormidium sp. PBR-2020: JWS08_11070 Help Entry JWS08_11070       CDS       T07578                                  Symbol psbE Name (GenBank) cytochrome b559 subunit alpha   KO K02707   photosystem II cytochrome b559 subunit alpha Organism phor  Phormidium sp. PBR-2020 Pathway phor00195   Photosynthesis phor01100   Metabolic pathways Module phor_M00161   Photosystem II phor_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:phor00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     JWS08_11070 (psbE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:phor00194]     JWS08_11070 (psbE) Photosynthesis proteins [BR:phor00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     JWS08_11070 (psbE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  UCJ10410 LinkDB All DBs Position complement(2527883..2528128) Genome browser AA seq 81 aa AA seqDB search MAGTTGERPFSDIITSVRYWLIHAVTIPMLFIAGWFFVSTGLAYDAFGTPRPDEYYTKQR LELPIVSDRFEGRQQIEQFIK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcaggcacaactggagaacgtccgttttcagatattattaccagcgtccgctactgg ttgattcatgcggtgaccattcccatgctctttattgcgggttggttttttgtgagtacc ggcttggcttacgatgcgttcggcacgcctcgcccggatgagtactacacgaaacaacgg ctggaattgccgatcgtctccgatcgctttgaaggccgtcaacaaatcgaacagtttatc aaataa

DBGET integrated database retrieval system