Phormidium sp. PBR-2020: JWS08_14145 Help Entry JWS08_14145       CDS       T07578                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phor  Phormidium sp. PBR-2020 Pathway phor01100   Metabolic pathways phor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JWS08_14145    00074 Mycolic acid biosynthesis     JWS08_14145   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JWS08_14145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N Grg1 Motif Other DBs NCBI-ProteinID:  UCJ10951 LinkDB All DBs Position 3202179..3202433 Genome browser AA seq 84 aa AA seqDB search MSQTNVSEKVQEIVVEHLGVEASQVKEAASFIEDLGADSLDTVELVMAFEEEFDIEIPDE DAEKILTVKDAVNYIQEKSAAAQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagtcaaacgaacgtttcagaaaaagtccaagaaattgtcgtggaacacttgggtgtt gaagccagccaagttaaagaagcagccagtttcattgaagacctcggtgccgattctctc gacactgtggaattagtcatggcctttgaagaagaatttgatatcgaaattcccgatgaa gatgccgaaaaaattctgacggtcaaagatgccgttaactatatccaagaaaaatcagcc gctgctcaagcctag

DBGET integrated database retrieval system