Phaeobacter sp. LSS9: D1820_01120 Help Entry D1820_01120       CDS       T05617                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism phq  Phaeobacter sp. LSS9 Pathway phq00030   Pentose phosphate pathway phq00051   Fructose and mannose metabolism phq00710   Carbon fixation by Calvin cycle phq01100   Metabolic pathways phq01110   Biosynthesis of secondary metabolites phq01120   Microbial metabolism in diverse environments phq01200   Carbon metabolism phq01230   Biosynthesis of amino acids Module phq_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:phq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     D1820_01120 (rpiB)    00051 Fructose and mannose metabolism     D1820_01120 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     D1820_01120 (rpiB) Enzymes [BR:phq01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      D1820_01120 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB DUF4177 Motif Other DBs NCBI-ProteinID:  AXT33678 LinkDB All DBs Position 232926..233381 Genome browser AA seq 151 aa AA seqDB search MDQKKPTRVVLSSDHAAIELRQAIADHIAANGWEVVDIGPTTPESTHYPKHGAAAAERVA SGDCDLGIILCGTGQGIMMAANKVKGIRCGVCSETFSAKMIRQHNNANMLSIGARVVGDS LAIEIVDAFLNAEFEGGRHATRVDMIEPQDS NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggaccagaaaaaaccgacccgcgttgtgctttccagcgaccacgccgcgattgagctg cgccaggccatcgcggatcacattgccgccaacggctgggaggtcgtcgacattggcccc accaccccggagagcacccattaccccaagcacggcgcagccgcggcggagcgtgtggcc tcgggcgattgcgatctcgggatcattctttgcggcaccggtcagggcatcatgatggcc gcaaacaaggtgaagggcatccgttgcggcgtctgctctgaaaccttctccgccaagatg atccgccagcacaacaacgccaatatgctctccatcggggcgcgtgtggttggtgacagc ctggcgattgagattgttgatgccttcctcaatgctgagtttgaaggcggtcgccacgcc acccgcgtggatatgattgagccgcaggacagctga

DBGET integrated database retrieval system