Phaeobacter sp. LSS9: D1820_03965 Help Entry D1820_03965       CDS       T05617                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phq  Phaeobacter sp. LSS9 Pathway phq01100   Metabolic pathways phq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D1820_03965    00074 Mycolic acid biosynthesis     D1820_03965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D1820_03965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AXT36668 LinkDB All DBs Position complement(811560..811814) Genome browser AA seq 84 aa AA seqDB search MSTQDKVIAIIAEQAVLEPSDVTLDSTLEDLGIDSLGLVESIFAIEEEFDITIPFNANEP EKSDFDISNVAAIIAGIDTLISEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcacgcaggacaaggtcatcgccatcattgccgaacaggccgtgctggagccatcg gatgtgacactcgacagcacactggaggatctggggatcgacagcctcggcctcgttgag agcatcttcgccattgaggaagagtttgatatcaccattcccttcaatgccaatgaaccg gagaaaagcgatttcgacatctccaacgtggcggcgatcatcgcgggtatcgacacgctg atttcagaaaaatga

DBGET integrated database retrieval system