Paraburkholderia hospita: C2L64_04605 Help Entry C2L64_04605       CDS       T05305                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phs  Paraburkholderia hospita Pathway phs00998   Biosynthesis of various antibiotics phs01100   Metabolic pathways phs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2L64_04605   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2L64_04605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AUT67698 LinkDB All DBs Position 1:1023743..1023982 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgttgcagaacaactcggtgttgccgaa gcggaaatcaagaacgaagcatcgttcgtgaacgacctcggcgctgactcgctcgacacg gtcgagctggtgatggctctcgaagacgaattcggcatggaaattccggatgaagaagcc gagaagatcacgacggttcagcaagcgatcgactacgctcgcgctaacgtcaaggcctaa

DBGET integrated database retrieval system