Paraburkholderia hospita: C2L64_33895 Help Entry C2L64_33895       CDS       T05305                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism phs  Paraburkholderia hospita Brite KEGG Orthology (KO) [BR:phs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:phs03032]     C2L64_33895    03036 Chromosome and associated proteins [BR:phs03036]     C2L64_33895    03400 DNA repair and recombination proteins [BR:phs03400]     C2L64_33895 DNA replication proteins [BR:phs03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C2L64_33895 Chromosome and associated proteins [BR:phs03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C2L64_33895 DNA repair and recombination proteins [BR:phs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C2L64_33895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AUT73373 UniProt:  A0AAJ5BXH8 LinkDB All DBs Position 3:159728..160006 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAASTGESKASTGGAIDAILEAVTAAVTRGDTVQLIGFGSFSTGARAERTG RNPSTGATITIPAAKTVKFTAGKGFKDAVNAG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactcatcgacgccgtcgccgcgagcacgggtgaaagcaaggctagt acgggcggcgcgattgatgccatcctcgaggccgtgacggcagcagtgacgcgtggcgat acagtccagctgattggtttcggctcattttcgacgggcgctcgcgccgaacgcacgggt cgcaacccgtcgacgggcgcgaccatcacgatcccggcggcgaagaccgtcaagttcaca gcaggcaaggggttcaaggacgctgtgaatgccgggtga

DBGET integrated database retrieval system