Primulina huaijiensis: 140968292 Help Entry 140968292         CDS       T11038                                  Name (RefSeq) polyubiquitin 9   KO K03873   elongin-B Organism phua  Primulina huaijiensis Pathway phua04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:phua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     140968292  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:phua04121]     140968292    03400 DNA repair and recombination proteins [BR:phua03400]     140968292 Ubiquitin system [BR:phua04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      140968292    Cul5 complex      140968292 DNA repair and recombination proteins [BR:phua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      140968292 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD UBL_UBAC1 Ubiquitin_2 Dsc3_N Chal_sti_synt_N GABP-alpha Motif Other DBs NCBI-GeneID:  140968292 NCBI-ProteinID:  XP_073285308 LinkDB All DBs Position 2:complement(19991563..19995362) Genome browser AA seq 104 aa AA seqDB search MAMYIRVKREKTTYFLQCVPSETILQIKEKLQELIDQPANNQRLILMSNREVLDDSKSLA DQKVENDAVVALTLRKDDNEFEDVNIVRPNDFYQSHDSEASSNW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcaatgtatatccgtgttaaacgtgagaagacaacttacttcctgcaatgcgttcca agtgagacgattctacaaatcaaggagaagttgcaagaactcattgatcagccggctaac aatcaaagactgatactcatgtcaaatcgggaagtgttggatgattcaaaatccttggca gatcaaaaggttgaaaatgatgctgtcgtcgccctgactctgagaaaagatgataatgag ttcgaggatgtaaatatcgtgcggccaaatgatttctaccagtcccatgactcggaagct agttctaattggtga

DBGET integrated database retrieval system