Primulina huaijiensis: 140978082 Help Entry 140978082         CDS       T11038                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism phua  Primulina huaijiensis Pathway phua04145   Phagocytosis phua04517   IgSF CAM signaling phua04814   Motor proteins Brite KEGG Orthology (KO) [BR:phua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     140978082  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     140978082   09142 Cell motility    04814 Motor proteins     140978082  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:phua03037]     140978082    04812 Cytoskeleton proteins [BR:phua04812]     140978082 Cilium and associated proteins [BR:phua03037]  Motile cilia and associated proteins   Dynein arm    140978082 Cytoskeleton proteins [BR:phua04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      140978082 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ectatomin Motif Other DBs NCBI-GeneID:  140978082 NCBI-ProteinID:  XP_073298961 LinkDB All DBs Position 6:complement(21636984..21637798) Genome browser AA seq 92 aa AA seqDB search MLERRGLVEDTDMPLKMQIQAMGFASQALDLYDVLDCKSIAAHIKKECDKEYGNGWQCVV GSNFGCFFTHKKGSFIYFTLETLNFLIFKGSS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgttggaaaggagaggtttggtagaggatacagatatgcctttgaagatgcagatccaa gcaatgggttttgcttctcaagctctggatctctatgatgtcttggactgcaaatctatt gctgcccacatcaagaaggaatgtgacaaggaatatgggaatggatggcagtgtgtggtg ggatccaacttcgggtgctttttcacgcacaaaaagggtagtttcatatacttcacactt gagacactcaacttcctcatcttcaaaggctcttcatga

DBGET integrated database retrieval system