Paraburkholderia kururiensis: U0042_08835 Help Entry U0042_08835       CDS       T10320                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phun  Paraburkholderia kururiensis Pathway phun01100   Metabolic pathways phun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U0042_08835    00074 Mycolic acid biosynthesis     U0042_08835   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U0042_08835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Raf1_N Motif Other DBs NCBI-ProteinID:  WQD79764 UniProt:  A0ABZ0WQT1 LinkDB All DBs Position 1958751..1959002 Genome browser AA seq 83 aa AA seqDB search MTEADILERIRAIFHENFAIDPARVTPEAHLFEELDLDSIDAVDLAIKLQEMTGRRIKPE EFKSVRTVGDVIAAVESLLAAQA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaccgaagcagacattctcgagcgcatccgcgccatctttcacgaaaacttcgcgatc gacccggcgcgcgtgacgccggaggcgcatctgttcgaagaactggatctggacagcatc gacgccgtcgatctcgccatcaagctgcaggaaatgaccggccggcgcatcaagccggaa gagttcaagtcggttcgcacggtgggcgacgtgatcgccgctgtggaatcgctgctcgcg gctcaggcttga

DBGET integrated database retrieval system