KEGG   Paraburkholderia kururiensis: U0042_13690
Entry
U0042_13690       CDS       T10320                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
phun  Paraburkholderia kururiensis
Pathway
phun02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    U0042_13690 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:phun02022]
    U0042_13690 (phoB)
Two-component system [BR:phun02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   U0042_13690 (phoB)
SSDB
Motif
Pfam: Trans_reg_C Response_reg HTH_11
Other DBs
NCBI-ProteinID: WQD80645
UniProt: A0ABZ0WTB6
LinkDB
Position
complement(3087059..3087760)
AA seq 233 aa
MPSSILVIEDEPAISELISVNLQHAGHCPIRAYNAEQAQNLISDVLPDLILLDWMLPGKS
GIAFARDLRNNERTRHIPIIMLTARGDEQDKVLGLEIGADDYVTKPFSPKELMARIKAVL
RRRAPQLTEDVVAINGLKLDPATHRVAAHSDGSEIKLDLGPTEFRLLHFFMTHPERVHSR
TQLLDQVWGDHVFVEERTVDVHIKRLRAALKPAGCDAMIETVRGSGYRLAKSA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcctagcagcattcttgtcatcgaagacgaacccgcgatttccgagcttatttcggtg
aacctccagcatgcgggccattgcccgattcgcgcgtacaacgcggagcaggcgcagaac
ctgatcagcgacgtgctgccggatctgatcctgctcgactggatgttgccgggcaagtcg
ggcatcgctttcgcccgcgatctgcgcaacaacgagcgcacgagacacatccccatcatc
atgctgacggcgcgtggcgacgagcaggacaaggtgctcggcctcgagatcggcgcggac
gactacgtgaccaagccgttctcgccgaaggaactgatggcgcgcatcaaggcggtgctg
cgccgtcgcgcgccgcagctcaccgaggacgtggtggcgatcaacggtctcaagctcgat
cccgccacgcatcgtgtggcggcgcattcggacggcagcgaaatcaagctcgacctcggc
cccaccgaattccgtctgctgcatttcttcatgacgcatccggagcgcgtgcacagccgc
acgcagttgctcgaccaggtgtggggcgatcacgtgttcgtcgaagagcgcaccgtggat
gtccatatcaagcgtctgcgggccgcgctcaagccggcgggctgcgacgccatgatcgag
acggtgcgcggcagcggctaccgtcttgcgaagagcgcctga

DBGET integrated database retrieval system