Paraburkholderia kururiensis: U0042_13995 Help Entry U0042_13995       CDS       T10320                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phun  Paraburkholderia kururiensis Pathway phun01100   Metabolic pathways phun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U0042_13995 (acpP)    00074 Mycolic acid biosynthesis     U0042_13995 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U0042_13995 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  WQD80698 UniProt:  A0ABZ0WTG1 LinkDB All DBs Position complement(3154218..3154457) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacagcgcgtcaagaagatcgtcgcggaacaactgggcgtagccgaa gcggaaatcaagaacgaagcgtcgttcgtgaacgatctcggcgcggactcgctcgatacc gtcgaactggtcatggccctcgaagacgaattcggcatggaaattccggatgaggaagcc gaaaagatcacgaccgtccagcaggctatcgactacgcccgcgcgaacgtcaaggcctga

DBGET integrated database retrieval system