Pseudomonas hamedanensis: HU739_015360 Help Entry HU739_015360      CDS       T07661                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phv  Pseudomonas hamedanensis Pathway phv01100   Metabolic pathways phv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU739_015360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU739_015360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXI15298 UniProt:  A0A9E6NWS5 LinkDB All DBs Position 3566438..3566710 Genome browser AA seq 90 aa AA seqDB search MSDLNNPDLMRDIKLLIIDALGLEDVGPDDIGDEQTLFGEGLGLDSVDALELGLAIQKKY GIKIDADAKDTRNHFTNVASLAAFVTAKAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgatttgaacaaccctgacctgatgcgtgacatcaaactgctgatcatcgacgcc ctcggcctcgaagacgttggccccgacgacatcggtgacgagcagacgctgtttggcgaa ggcctgggtctggactcggtcgacgcgctggaactgggtctggcgatccagaaaaaatac ggcatcaagatcgacgccgatgccaaagacactcgcaaccatttcaccaacgtggcgagc cttgcggctttcgtcacggccaaagcagcttga

DBGET integrated database retrieval system