Pseudomonas hamedanensis: HU739_021380 Help Entry HU739_021380      CDS       T07661                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phv  Pseudomonas hamedanensis Pathway phv01100   Metabolic pathways phv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU739_021380 (acpP)    00074 Mycolic acid biosynthesis     HU739_021380 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU739_021380 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB NirdL-like_HTH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QXI16447 UniProt:  A0A9E6TFY5 LinkDB All DBs Position complement(4903915..4904151) Genome browser AA seq 78 aa AA seqDB search MSDIESRVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgaatcgcgcgtcaagaaaatcgttgccgagcaactgggtgttaaagaa gaagaagtggtcaacactgcttccttcgtagaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gaaaagatcactactgtacaagctgcaatcgactacgttactgcccaccaggcgtaa

DBGET integrated database retrieval system