Phycicoccus sp. HDW14: G7075_04810 Help Entry G7075_04810       CDS       T06484                                  Name (GenBank) hypothetical protein   KO K00788   thiamine-phosphate pyrophosphorylase [EC:2.5.1.3] Organism phw  Phycicoccus sp. HDW14 Pathway phw00730   Thiamine metabolism phw01100   Metabolic pathways phw01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:phw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00730 Thiamine metabolism     G7075_04810 Enzymes [BR:phw01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.3  thiamine phosphate synthase      G7075_04810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gly_transf_sug Motif Other DBs NCBI-ProteinID:  QIM20629 UniProt:  A0A6G8FWM3 LinkDB All DBs Position 955542..955832 Genome browser AA seq 96 aa AA seqDB search MTSFRVDAEAVLEVGASLVELAEGLAAMGDPHADAWALGPGRSGAALEELLGGWRHARLQ LAGSLADLGAAAAEAGGAYLDTDVGVSRSLDGGPTW NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacgtcgttccgggtcgatgcagaggccgtcctcgaagtgggggcctccctcgtcgag ctcgccgagggcctggcggcgatgggcgacccgcacgccgacgcgtgggccctcggcccg ggccgcagcggtgcggcgctcgaggagctgctcggcggctggcggcacgcccgcctgcag ctggccggctcgctcgccgacctcggggcggccgcggccgaggccggtggtgcctacctc gacaccgacgtcggggtctcccgcagcctcgacgggggtcccacgtggtga

DBGET integrated database retrieval system