Phycicoccus sp. HDW14: G7075_08195 Help Entry G7075_08195       CDS       T06484                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phw  Phycicoccus sp. HDW14 Pathway phw01100   Metabolic pathways phw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G7075_08195    00074 Mycolic acid biosynthesis     G7075_08195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G7075_08195 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIM21110 LinkDB All DBs Position 1664144..1664389 Genome browser AA seq 81 aa AA seqDB search MADQQEILSGLAEIVNEETGLDPAEVQMDKSFTDDLDIDSLSMMTIVVNAEEKFGVRIPD DEVKNLATVGDAVNFIQSNQG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcagaccagcaggagatcctcagcggcctcgcggagatcgtcaacgaggagaccggc ctggacccggccgaggtccagatggacaagtccttcaccgacgacctcgacatcgactcg ctgtcgatgatgaccatcgtcgtcaacgccgaggagaagttcggcgtccgcatccccgac gacgaggtcaagaacctcgccacggtcggcgacgcggtcaacttcatccagtccaaccag ggctga

DBGET integrated database retrieval system