Phycicoccus sp. HDW14: G7075_17775 Help Entry G7075_17775       CDS       T06484                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism phw  Phycicoccus sp. HDW14 Brite KEGG Orthology (KO) [BR:phw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:phw03032]     G7075_17775    03036 Chromosome and associated proteins [BR:phw03036]     G7075_17775    03400 DNA repair and recombination proteins [BR:phw03400]     G7075_17775 DNA replication proteins [BR:phw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G7075_17775 Chromosome and associated proteins [BR:phw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G7075_17775 DNA repair and recombination proteins [BR:phw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G7075_17775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-DNA_bdg DUF2267 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QIM22551 UniProt:  A0A6G8G1R9 LinkDB All DBs Position complement(3607272..3607550) Genome browser AA seq 92 aa AA seqDB search MSTKKDIAQAVASRTDVSASAAEEIINAAFDVVAEHLAKGEDVKLAGFGSFETRARAART GRNPQTGEEIQIAASTSVGFKAAAQLKRAVNG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccaagaaggacatcgcccaggccgtcgcttcgcgcacggacgtctccgcgtcc gccgccgaggagatcatcaacgcggcattcgacgtcgtcgccgagcacctcgccaagggc gaggacgtcaagctcgccggcttcggcagcttcgagacccgcgcccgcgccgcgcgcacc ggccgcaacccgcagaccggcgaggagatccagatcgccgcctcgacgtcggtcggcttc aaggccgccgcgcagctcaagcgcgccgtcaacggctga

DBGET integrated database retrieval system