Pseudothermotoga hypogea: AJ81_02065 Help Entry AJ81_02065        CDS       T04277                                  Name (GenBank) YruB family glutaredoxin   KO K03676   glutaredoxin 3 Organism phy  Pseudothermotoga hypogea Brite KEGG Orthology (KO) [BR:phy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:phy03110]     AJ81_02065 Chaperones and folding catalysts [BR:phy03110]  Protein folding catalysts   Protein disulfide isomerase    AJ81_02065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 GST_N Thioredoxin_4 Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  AJC73189 UniProt:  A0A0X1KPP1 LinkDB All DBs Position complement(381913..382155) Genome browser AA seq 80 aa AA seqDB search MQHIKITIYTTPTCPYCARAKSYLRQLGLKFTEVDVSRDPVAAERLVKKTGQTGVPVIEI GNQIVIGFDKEKIDRILGVR NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcaacacatcaaaataacaatttacaccacacccacgtgcccatactgcgcgagggca aaaagttacttgagacagctcggtctcaaattcaccgaggtggatgtctcgcgtgatcca gtggcggcggaacgcttggtcaaaaagactggtcaaacgggagttcccgtgatcgagatc ggcaatcaaatagtcataggttttgataaagagaagatagacaggatcttgggagtgaga tga

DBGET integrated database retrieval system