Pseudothermotoga hypogea: AJ81_03025 Help Entry AJ81_03025        CDS       T04277                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism phy  Pseudothermotoga hypogea Pathway phy00010   Glycolysis / Gluconeogenesis phy00020   Citrate cycle (TCA cycle) phy00620   Pyruvate metabolism phy00640   Propanoate metabolism phy00650   Butanoate metabolism phy00680   Methane metabolism phy00720   Other carbon fixation pathways phy01100   Metabolic pathways phy01110   Biosynthesis of secondary metabolites phy01120   Microbial metabolism in diverse environments phy01200   Carbon metabolism phy01210   2-Oxocarboxylic acid metabolism Module phy_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:phy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     AJ81_03025    00020 Citrate cycle (TCA cycle)     AJ81_03025    00620 Pyruvate metabolism     AJ81_03025    00640 Propanoate metabolism     AJ81_03025    00650 Butanoate metabolism     AJ81_03025   09102 Energy metabolism    00720 Other carbon fixation pathways     AJ81_03025    00680 Methane metabolism     AJ81_03025   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     AJ81_03025 Enzymes [BR:phy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      AJ81_03025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_6 Fer4_10 Fer4_16 Fer4_9 Fer4_2 Fer4_13 Fer4_4 Fer4_15 Fer4_17 DUF4723 Fer4_8 Fer4_18 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  AJC73352 UniProt:  A0A0X1KQ13 LinkDB All DBs Position complement(579753..580055) Genome browser AA seq 100 aa AA seqDB search MAELKKWHELPIAGLIVEPGTARKYRTGDWRVKRPVYDRSKCIDCMFCWFYCPDQAIIQE KGVMKGIDYFYCKGCGVCANVCPKSAIEMRPETEFVGKED NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtggctgagttgaaaaaatggcatgagttgcctatagcgggcttgatagtggaaccagga actgcacgaaagtatagaaccggtgattggcgtgtcaagagacccgtatacgatagatcc aagtgcatagattgtatgttctgctggttctattgtcctgatcaagcgatcatccaggaa aaaggtgtaatgaaaggaatcgactatttttactgcaagggctgtggtgtgtgtgcgaac gtctgtccaaagtccgccatcgagatgcgcccggagacagagttcgtaggaaaggaggac tga

DBGET integrated database retrieval system