Pseudothermotoga hypogea: AJ81_10415 Help Entry AJ81_10415        CDS       T04277                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism phy  Pseudothermotoga hypogea Pathway phy02024   Quorum sensing phy03018   RNA degradation Brite KEGG Orthology (KO) [BR:phy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AJ81_10415  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AJ81_10415  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:phy03019]     AJ81_10415    03036 Chromosome and associated proteins [BR:phy03036]     AJ81_10415 Messenger RNA biogenesis [BR:phy03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AJ81_10415 Chromosome and associated proteins [BR:phy03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AJ81_10415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM DUF4809 EndoS_Ig-like Glyco_hydro_100 Motif Other DBs NCBI-ProteinID:  AJC74522 UniProt:  A0A0X1KTJ8 LinkDB All DBs Position complement(2079800..2080078) Genome browser AA seq 92 aa AA seqDB search MAEKFNLQDRFLNTLRTSKIEVKVYLVNGFQTKGIIRSFDSYTILLENENQQSLIYKHAI STIMPTSFVRLVKTEQKEKEEASQAQPDGSDE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcagagaagttcaatcttcaggacaggtttctcaacactctacgcaccagcaagatc gaagtcaaagtttacctggtgaacggttttcaaaccaaagggatcattcgttctttcgac agttacacgatcttgctggagaacgagaaccagcagagtctcatctacaagcacgcgata agcacgataatgccaacatcgttcgtcaggcttgtgaaaaccgaacagaaggaaaaggag gaagcatcacaggctcaaccagatggttcggacgaatga

DBGET integrated database retrieval system