Pseudomonas hygromyciniae: JTY93_02005 Help Entry JTY93_02005       CDS       T09404                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism phyg  Pseudomonas hygromyciniae Pathway phyg01100   Metabolic pathways phyg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:phyg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JTY93_02005    00074 Mycolic acid biosynthesis     JTY93_02005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JTY93_02005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSB40201 LinkDB All DBs Position complement(470944..471213) Genome browser AA seq 89 aa AA seqDB search MSNPNSLEHDIKTLIIEALGLEDIEVSDIGNEQTLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFINVASLAAFVTAKQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccaacagccttgagcacgacattaaaaccctgatcatcgaggccctgggc ctggaagatatagaggtcagcgacatcggcaacgagcaaaccctgttcggcgaaggcctg ggcctggattcggtagatgccctggaattgggcctggcgatccagaaaaaatacggcatc aagatcgatgccgacgccaaggacacccgcaatcactttatcaacgtggccagcctcgcg gcgttcgtcacggccaaacaggcagcttga

DBGET integrated database retrieval system